PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca30741.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family FAR1
Protein Properties Length: 161aa    MW: 17802 Da    PI: 4.962
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca30741.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR126.71.9e-08107149244
        FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreee 44 
                  Y+++A+ +GFs rks+++  k +  ++++++vC++eg+r+e+
  Dca30741.1 107 LYSQHANAIGFSARKSTQRLAKGSLMVKEKHYVCNNEGTRSES 149
                 7**************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.0E-5107149IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MEVSCIQQIH DSQSNVTYIQ NSPTIAVSCS QHVQSIVMSL QPDSIVKVPS NQHIHDLQSN  60
IQQEELASEL QIQATEEVVD PIIEGQSDVS GSLVGRKSKD LDELFELYSQ HANAIGFSAR  120
KSTQRLAKGS LMVKEKHYVC NNEGTRSESS LGGKILIFME M
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-